Lineage for d1v2za1 (1v2z A:174-278)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014415Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
    4 helices; bundle, right-handed twist; right-handed superhelix
  4. 2014416Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) (S)
  5. 2014417Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)
  6. 2014418Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species)
  7. 2014424Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (5 PDB entries)
    Uniprot Q79V62 174-283
  8. 2014425Domain d1v2za1: 1v2z A:174-278 [108300]
    Other proteins in same PDB: d1v2za2

Details for d1v2za1

PDB Entry: 1v2z (more details), 1.8 Å

PDB Description: Crystal structure of the C-terminal domain of Thermosynechococcus elongatus BP-1 KaiA
PDB Compounds: (A:) Circadian clock protein KaiA homolog

SCOPe Domain Sequences for d1v2za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2za1 a.186.1.1 (A:174-278) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1 [TaxId: 197221]}
tafffrrmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvl
eihvelmdtfskqlklegrsedilldyrltlidviahlcemyrrs

SCOPe Domain Coordinates for d1v2za1:

Click to download the PDB-style file with coordinates for d1v2za1.
(The format of our PDB-style files is described here.)

Timeline for d1v2za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v2za2