![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins) |
![]() | Protein Trypsin(ogen) [50515] (8 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50516] (229 PDB entries) |
![]() | Domain d1v2wt_: 1v2w T: [108299] |
PDB Entry: 1v2w (more details), 1.75 Å
SCOP Domain Sequences for d1v2wt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v2wt_ b.47.1.2 (T:) Trypsin(ogen) {Cow (Bos taurus)} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksassaiitsnmfcagyleggkdscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d1v2wt_: