![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) ![]() |
![]() | Family c.67.1.1: AAT-like [53384] (10 proteins) |
![]() | Protein Glutamine aminotransferase [110677] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [110678] (3 PDB entries) |
![]() | Domain d1v2fb_: 1v2f B: [108285] |
PDB Entry: 1v2f (more details), 2.35 Å
SCOP Domain Sequences for d1v2fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v2fb_ c.67.1.1 (B:) Glutamine aminotransferase {Thermus thermophilus} mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyapp aglpalrealaeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaf lagakarlvrldltpegfrldlsalekaltprtralllntpmnptglvfgereleaiarl arahdlflisdevydelyygerprrlrefapertftvgsagkrleatgyrvgwivgpkef mprlagmrqwtsfsaptplqagvaealklarregfyealregyrrrrdllagglramglr vyvpegtyflmaelpgwdafrlveearvalipasafyledppkdlfrfafckteeelhla lerlgrv
Timeline for d1v2fb_: