Lineage for d1v2eb_ (1v2e B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490721Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 490722Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 490723Family c.67.1.1: AAT-like [53384] (10 proteins)
  6. 490913Protein Glutamine aminotransferase [110677] (1 species)
  7. 490914Species Thermus thermophilus [TaxId:274] [110678] (3 PDB entries)
  8. 490919Domain d1v2eb_: 1v2e B: [108283]

Details for d1v2eb_

PDB Entry: 1v2e (more details), 2.6 Å

PDB Description: Crystal Structure of T.th HB8 Glutamine Aminotransferase complex with a-keto-g-methylthiobutyrate

SCOP Domain Sequences for d1v2eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2eb_ c.67.1.1 (B:) Glutamine aminotransferase {Thermus thermophilus}
mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyapp
aglpalrealaeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaf
lagakarlvrldltpegfrldlsalekaltprtralllntpmnptglvfgereleaiarl
arahdlflisdevydelyygerprrlrefapertftvgsagkrleatgyrvgwivgpkef
mprlagmrqwtsfsaptplqagvaealklarregfyealregyrrrrdllagglramglr
vyvpegtyflmaelpgwdafrlveearvalipasafyledppkdlfrfafckteeelhla
lerlgrv

SCOP Domain Coordinates for d1v2eb_:

Click to download the PDB-style file with coordinates for d1v2eb_.
(The format of our PDB-style files is described here.)

Timeline for d1v2eb_: