Lineage for d1v26b_ (1v26 B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2625032Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2625033Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2625034Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 proteins)
  6. 2625077Protein Long chain fatty acid-CoA ligase TT0168 [111314] (1 species)
  7. 2625078Species Thermus thermophilus [TaxId:274] [111315] (3 PDB entries)
    Uniprot Q6L8F0
  8. 2625082Domain d1v26b_: 1v26 B: [108278]
    Structural genomics target
    complexed with amp, mg, myr

Details for d1v26b_

PDB Entry: 1v26 (more details), 2.5 Å

PDB Description: Crystal structure of tt0168 from Thermus thermophilus HB8
PDB Compounds: (B:) long-chain-fatty-acid-CoA synthetase

SCOPe Domain Sequences for d1v26b_:

Sequence, based on SEQRES records: (download)

>d1v26b_ e.23.1.1 (B:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]}
afpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglral
gvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfdp
nllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttgt
tglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgakq
vlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvvggsaapr
sliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglpiplvrlr
vadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdiavwdeegy
veikdrlkdliksggewissvdlenalmghpkvkeaavvaiphpkwqerplavvvprgek
ptpeelnehllkagfakwqlpdayvfaeeiprtsagkflkralreqyknyygga

Sequence, based on observed residues (ATOM records): (download)

>d1v26b_ e.23.1.1 (B:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]}
afpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglral
gvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfdp
nllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttgt
tglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgakq
vlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvvggsaapr
sliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglpiplvrlr
vadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdiavwdeegy
veikdrlkdliksggewissvdlenaaavvaiphpkwqerplavtpeelnehllkagfak
wqlpdayvfaeeiprtralreqyknyygga

SCOPe Domain Coordinates for d1v26b_:

Click to download the PDB-style file with coordinates for d1v26b_.
(The format of our PDB-style files is described here.)

Timeline for d1v26b_: