Lineage for d1v26a_ (1v26 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249472Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2249473Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2249474Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 proteins)
  6. 2249517Protein Long chain fatty acid-CoA ligase TT0168 [111314] (1 species)
  7. 2249518Species Thermus thermophilus [TaxId:274] [111315] (3 PDB entries)
    Uniprot Q6L8F0
  8. 2249521Domain d1v26a_: 1v26 A: [108277]
    Structural genomics target
    complexed with amp, mg, myr

Details for d1v26a_

PDB Entry: 1v26 (more details), 2.5 Å

PDB Description: Crystal structure of tt0168 from Thermus thermophilus HB8
PDB Compounds: (A:) long-chain-fatty-acid-CoA synthetase

SCOPe Domain Sequences for d1v26a_:

Sequence, based on SEQRES records: (download)

>d1v26a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]}
afpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglral
gvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfdp
nllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttgt
tglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgakq
vlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvvggsaapr
sliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglpiplvrlr
vadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdiavwdeegy
veikdrlkdliksggewissvdlenalmghpkvkeaavvaiphpkwqerplavvvprgek
ptpeelnehllkagfakwqlpdayvfaeeiprtsagkflkralreqyknyyg

Sequence, based on observed residues (ATOM records): (download)

>d1v26a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]}
afpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglral
gvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfdp
nllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttgt
tglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgakq
vlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvvggsaapr
sliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglpiplvrlr
vadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdiavwdeegy
veikdrlkdliksggewissvdlenaavvaiphpkwqerplavvgfakwqlpdaylkral
reqyknyyg

SCOPe Domain Coordinates for d1v26a_:

Click to download the PDB-style file with coordinates for d1v26a_.
(The format of our PDB-style files is described here.)

Timeline for d1v26a_: