Lineage for d1v25b_ (1v25 B:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 518655Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 518656Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (1 family) (S)
  5. 518657Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (6 proteins)
  6. 518675Protein Long chain fatty acid-CoA ligase TT0168 [111314] (1 species)
  7. 518676Species Thermus thermophilus [TaxId:274] [111315] (3 PDB entries)
  8. 518678Domain d1v25b_: 1v25 B: [108276]
    Structural genomics target

Details for d1v25b_

PDB Entry: 1v25 (more details), 2.3 Å

PDB Description: Crystal structure of tt0168 from Thermus thermophilus HB8

SCOP Domain Sequences for d1v25b_:

Sequence, based on SEQRES records: (download)

>d1v25b_ e.23.1.1 (B:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus}
afpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglral
gvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfdp
nllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttgt
tglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgakq
vlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvvggsaapr
sliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglpiplvrlr
vadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdiavwdeegy
veikdrlkdliksggewissvdlenalmghpkvkeaavvaiphpkwqerplavvvprgek
ptpeelnehllkagfakwqlpdayvfaeeiprtsagkflkralreqyknyygga

Sequence, based on observed residues (ATOM records): (download)

>d1v25b_ e.23.1.1 (B:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus}
afpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglral
gvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfdp
nllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttgt
tglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgakq
vlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvvggsaapr
sliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglpiplvrlr
vadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdiavwdeegy
veikdrlkdliksggewissvdlenalmghaavvaiphpkwqerplavnehllkagfakw
qlpdayvfgkflkralreqyknyygga

SCOP Domain Coordinates for d1v25b_:

Click to download the PDB-style file with coordinates for d1v25b_.
(The format of our PDB-style files is described here.)

Timeline for d1v25b_: