Lineage for d1v1rb2 (1v1r B:205-342)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 487348Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 487349Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 487380Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (3 proteins)
  6. 487384Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 487385Species Human (Homo sapiens) [TaxId:9606] [52928] (8 PDB entries)
  8. 487391Domain d1v1rb2: 1v1r B:205-342 [108274]
    Other proteins in same PDB: d1v1ra_, d1v1rb1

Details for d1v1rb2

PDB Entry: 1v1r (more details), 1.8 Å

PDB Description: crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine

SCOP Domain Sequences for d1v1rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1rb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens)}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

SCOP Domain Coordinates for d1v1rb2:

Click to download the PDB-style file with coordinates for d1v1rb2.
(The format of our PDB-style files is described here.)

Timeline for d1v1rb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v1rb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1v1ra_