SCOP 1.71: Domain d1v1pa1: 1v1p A:21-108

Lineage for d1v1pa1 (1v1p A:21-108)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)

6. Protein Exotoxin 1 (SET1, Superantigen-like protein 7) [110190] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110191] (2 PDB entries)

8. Domain d1v1pa1: 1v1p A:21-108 [108268]
   Other proteins in same PDB: d1v1pa2, d1v1pb2

Details for d1v1pa1

PDB Entry: 1v1p, 2.7 Å

PDB Description: the structure ssl from staphylococcus aureus from an orthorhombic crystal form

SCOP Domain Sequences for d1v1pa1:

Sequence; same for both SEQRES and ATOM records:

>d1v1pa1 b.40.2.2 (A:21-108) Exotoxin 1 (SET1, Superantigen-like protein 7) {Staphylococcus aureus}
hlhdirdlhryyssesfeysnvsgkvenyngsnvvrfnpqnhqlfllgkdkeqykeglqg
qnvfvvqelidpngrlstvggvtkknnk

Timeline for d1v1pa1:

• d1v1pa1 first appeared in SCOP 1.69
  
• d1v1pa1 appears in SCOP 1.73
  
• d1v1pa1 appears in the current release, SCOPe 2.08