SCOPe 2.06: Domain d1v1ob2: 1v1o B:109-213

Lineage for d1v1ob2 (1v1o B:109-213)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Exotoxin 1 (SET1, Superantigen-like protein 7) [110810] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110811] (2 PDB entries)
   Uniprot Q9ZFS5 36-231

8. Domain d1v1ob2: 1v1o B:109-213 [108267]
   Other proteins in same PDB: d1v1oa1, d1v1ob1

Details for d1v1ob2

PDB Entry: 1v1o, 2.75 Å

PDB Description: staphylococcal superantigen-like protein 7

PDB Compounds: (B:) exotoxin 1

SCOPe Domain Sequences for d1v1ob2:

Sequence; same for both SEQRES and ATOM records:

>d1v1ob2 d.15.6.1 (B:109-213) Exotoxin 1 (SET1, Superantigen-like protein 7) {Staphylococcus aureus [TaxId: 1280]}
nktsetntplfvnkvngedldasidsfliqkeeislkeldfkirqqlvnnyglykgtsky
gkiiinlkdenkveidlgdklqfermgdvlnskdirgisvtinqi

Timeline for d1v1ob2:

• d1v1ob2 first appeared in SCOP 1.69
  
• d1v1ob2 appears in SCOPe 2.05
  
• d1v1ob2 appears in SCOPe 2.07
  
• d1v1ob2 appears in the current release, SCOPe 2.08