Lineage for d1v1ob1 (1v1o B:18-108)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059072Protein Exotoxin 1 (SET1, Superantigen-like protein 7) [110190] (1 species)
  7. 2059073Species Staphylococcus aureus [TaxId:1280] [110191] (2 PDB entries)
    Uniprot Q9ZFS5 36-231
  8. 2059075Domain d1v1ob1: 1v1o B:18-108 [108266]
    Other proteins in same PDB: d1v1oa2, d1v1ob2

Details for d1v1ob1

PDB Entry: 1v1o (more details), 2.75 Å

PDB Description: staphylococcal superantigen-like protein 7
PDB Compounds: (B:) exotoxin 1

SCOPe Domain Sequences for d1v1ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1ob1 b.40.2.2 (B:18-108) Exotoxin 1 (SET1, Superantigen-like protein 7) {Staphylococcus aureus [TaxId: 1280]}
rvqhlhdirdlhryyssesfeysnvsgkvenyngsnvvrfnpkdqnhqlfllgkdkeqyk
eglqgqnvfvvqelidpngrlstvggvtkkn

SCOPe Domain Coordinates for d1v1ob1:

Click to download the PDB-style file with coordinates for d1v1ob1.
(The format of our PDB-style files is described here.)

Timeline for d1v1ob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v1ob2