SCOPe 2.05: Domain d1v1ob1: 1v1o B:18-108

Lineage for d1v1ob1 (1v1o B:18-108)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Exotoxin 1 (SET1, Superantigen-like protein 7) [110190] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110191] (2 PDB entries)
   Uniprot Q9ZFS5 36-231

8. Domain d1v1ob1: 1v1o B:18-108 [108266]
   Other proteins in same PDB: d1v1oa2, d1v1ob2

Details for d1v1ob1

PDB Entry: 1v1o, 2.75 Å

PDB Description: staphylococcal superantigen-like protein 7

PDB Compounds: (B:) exotoxin 1

SCOPe Domain Sequences for d1v1ob1:

Sequence; same for both SEQRES and ATOM records:

>d1v1ob1 b.40.2.2 (B:18-108) Exotoxin 1 (SET1, Superantigen-like protein 7) {Staphylococcus aureus [TaxId: 1280]}
rvqhlhdirdlhryyssesfeysnvsgkvenyngsnvvrfnpkdqnhqlfllgkdkeqyk
eglqgqnvfvvqelidpngrlstvggvtkkn

Timeline for d1v1ob1:

• d1v1ob1 first appeared in SCOP 1.69
  
• d1v1ob1 appears in SCOPe 2.04
  
• d1v1ob1 appears in SCOPe 2.06
  
• d1v1ob1 appears in the current release, SCOPe 2.08