Lineage for d1v1mb1 (1v1m B:2-204)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483377Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 483378Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 483487Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (3 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 483491Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species)
  7. 483492Species Human (Homo sapiens) [TaxId:9606] [88743] (8 PDB entries)
  8. 483497Domain d1v1mb1: 1v1m B:2-204 [108262]
    Other proteins in same PDB: d1v1ma_, d1v1mb2

Details for d1v1mb1

PDB Entry: 1v1m (more details), 2 Å

PDB Description: crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine

SCOP Domain Sequences for d1v1mb1:

Sequence, based on SEQRES records: (download)

>d1v1mb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens)}
ahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglr
dkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrs
gdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscied
knpciffepkilyraaaeevpie

Sequence, based on observed residues (ATOM records): (download)

>d1v1mb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens)}
ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk
drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn
cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci
ffepkilyraaaeevpie

SCOP Domain Coordinates for d1v1mb1:

Click to download the PDB-style file with coordinates for d1v1mb1.
(The format of our PDB-style files is described here.)

Timeline for d1v1mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v1mb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1v1ma_