![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module automatically mapped to Pfam PF02779 |
![]() | Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88743] (23 PDB entries) Uniprot P21953 52-392 |
![]() | Domain d1v1mb1: 1v1m B:2-204 [108262] Other proteins in same PDB: d1v1ma_, d1v1mb2 complexed with ben, cl, gol, k, mn, tdp |
PDB Entry: 1v1m (more details), 2 Å
SCOPe Domain Sequences for d1v1mb1:
Sequence, based on SEQRES records: (download)
>d1v1mb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} ahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglr dkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrs gdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscied knpciffepkilyraaaeevpie
>d1v1mb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci ffepkilyraaaeevpie
Timeline for d1v1mb1: