Lineage for d1v1ib1 (1v1i B:319-392)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426748Fold b.83: Triple beta-spiral [51224] (1 superfamily)
    trimer formed by the interlocking beta-hairpin repeat units
  4. 2426749Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (3 families) (S)
  5. 2426750Family b.83.1.1: Adenovirus [51226] (1 protein)
  6. 2426751Protein Adenovirus [51227] (1 species)
  7. 2426752Species Human adenovirus type 2 [TaxId:10515] [51228] (3 PDB entries)
    Uniprot P10104
  8. 2426760Domain d1v1ib1: 1v1i B:319-392 [108257]
    Other proteins in same PDB: d1v1ia2, d1v1ib2, d1v1ic2

Details for d1v1ib1

PDB Entry: 1v1i (more details), 1.9 Å

PDB Description: adenovirus fibre shaft sequence n-terminally fused to the bacteriophage t4 fibritin foldon trimerisation motif with a long linker
PDB Compounds: (B:) fibritin, fiber protein

SCOPe Domain Sequences for d1v1ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1ib1 b.83.1.1 (B:319-392) Adenovirus {Human adenovirus type 2 [TaxId: 10515]}
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitig

SCOPe Domain Coordinates for d1v1ib1:

Click to download the PDB-style file with coordinates for d1v1ib1.
(The format of our PDB-style files is described here.)

Timeline for d1v1ib1:

2426760
d1v1ib1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1v1ib2