SCOPe 2.05: Domain d1v1hd1: 1v1h D:319-392

Lineage for d1v1hd1 (1v1h D:319-392)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.83: Triple beta-spiral [51224] (1 superfamily)
   trimer formed by the interlocking beta-hairpin repeat units

4. Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (3 families)

5. Family b.83.1.1: Adenovirus [51226] (1 protein)

6. Protein Adenovirus [51227] (1 species)

7. Species Human adenovirus type 2 [TaxId:10515] [51228] (3 PDB entries)
   Uniprot P10104

8. Domain d1v1hd1: 1v1h D:319-392 [108249]
   Other proteins in same PDB: d1v1ha2, d1v1hb2, d1v1hc2, d1v1hd2, d1v1he2, d1v1hf2

Details for d1v1hd1

PDB Entry: 1v1h, 1.9 Å

PDB Description: adenovirus fibre shaft sequence n-terminally fused to the bacteriophage t4 fibritin foldon trimerisation motif with a short linker

PDB Compounds: (D:) fibritin, fiber protein

SCOPe Domain Sequences for d1v1hd1:

Sequence; same for both SEQRES and ATOM records:

>d1v1hd1 b.83.1.1 (D:319-392) Adenovirus {Human adenovirus type 2 [TaxId: 10515]}
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitig

Timeline for d1v1hd1:

• d1v1hd1 first appeared in SCOP 1.69
  
• d1v1hd1 appears in SCOPe 2.04
  
• d1v1hd1 appears in SCOPe 2.06
  
• d1v1hd1 appears in the current release, SCOPe 2.08