![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.83: Triple beta-spiral [51224] (1 superfamily) trimer formed by the interlocking beta-hairpin repeat units |
![]() | Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (3 families) ![]() |
![]() | Family b.83.1.1: Adenovirus [51226] (1 protein) |
![]() | Protein Adenovirus [51227] (1 species) |
![]() | Species Human adenovirus type 2 [TaxId:10515] [51228] (3 PDB entries) Uniprot P10104 |
![]() | Domain d1v1hd1: 1v1h D:319-392 [108249] Other proteins in same PDB: d1v1ha2, d1v1hb2, d1v1hc2, d1v1hd2, d1v1he2, d1v1hf2 |
PDB Entry: 1v1h (more details), 1.9 Å
SCOPe Domain Sequences for d1v1hd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1hd1 b.83.1.1 (D:319-392) Adenovirus {Human adenovirus type 2 [TaxId: 10515]} vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg aglsfdnsgaitig
Timeline for d1v1hd1: