Lineage for d1v1hb1 (1v1h B:319-392)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471199Fold b.83: Triple beta-spiral [51224] (1 superfamily)
    trimer formed by the interlocking beta-hairpin repeat units
  4. 471200Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (2 families) (S)
  5. 471201Family b.83.1.1: Adenovirus [51226] (1 protein)
  6. 471202Protein Adenovirus [51227] (1 species)
  7. 471203Species Human adenovirus type 2 [TaxId:10515] [51228] (3 PDB entries)
  8. 471205Domain d1v1hb1: 1v1h B:319-392 [108245]
    Other proteins in same PDB: d1v1ha2, d1v1hb2, d1v1hc2, d1v1hd2, d1v1he2, d1v1hf2

Details for d1v1hb1

PDB Entry: 1v1h (more details), 1.9 Å

PDB Description: adenovirus fibre shaft sequence n-terminally fused to the bacteriophage t4 fibritin foldon trimerisation motif with a short linker

SCOP Domain Sequences for d1v1hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1hb1 b.83.1.1 (B:319-392) Adenovirus {Human adenovirus type 2}
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitig

SCOP Domain Coordinates for d1v1hb1:

Click to download the PDB-style file with coordinates for d1v1hb1.
(The format of our PDB-style files is described here.)

Timeline for d1v1hb1: