Lineage for d1v16b2 (1v16 B:205-342)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488514Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2488515Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2488567Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
    automatically mapped to Pfam PF02780
  6. 2488571Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 2488572Species Human (Homo sapiens) [TaxId:9606] [52928] (23 PDB entries)
    Uniprot P21953 52-392
  8. 2488583Domain d1v16b2: 1v16 B:205-342 [108242]
    Other proteins in same PDB: d1v16a_, d1v16b1
    complexed with ben, cl, gol, k, mn, tdp

Details for d1v16b2

PDB Entry: 1v16 (more details), 1.9 Å

PDB Description: crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d1v16b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v16b2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

SCOPe Domain Coordinates for d1v16b2:

Click to download the PDB-style file with coordinates for d1v16b2.
(The format of our PDB-style files is described here.)

Timeline for d1v16b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v16b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1v16a_