Lineage for d1v15d_ (1v15 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2927847Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2927848Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2927849Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 2927868Protein DNase domain of colicin E9 [54064] (1 species)
  7. 2927869Species Escherichia coli [TaxId:562] [54065] (15 PDB entries)
    Uniprot P09883 456-581
  8. 2927891Domain d1v15d_: 1v15 D: [108239]
    complexed with zn; mutant

Details for d1v15d_

PDB Entry: 1v15 (more details), 2.4 Å

PDB Description: crystal structure of the colicin e9, mutant his103ala, in complex with zn+2 and dsdna (resolution 2.4a)
PDB Compounds: (D:) colicin e9

SCOPe Domain Sequences for d1v15d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v15d_ d.4.1.1 (D:) DNase domain of colicin E9 {Escherichia coli [TaxId: 562]}
eskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweev
skdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnirv
ttpkrhidihrgk

SCOPe Domain Coordinates for d1v15d_:

Click to download the PDB-style file with coordinates for d1v15d_.
(The format of our PDB-style files is described here.)

Timeline for d1v15d_: