![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
![]() | Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) ![]() common motif contains conserved histidine residue and metal-binding site |
![]() | Family d.4.1.1: HNH-motif [54061] (3 proteins) |
![]() | Protein DNase domain of colicin E9 [54064] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [54065] (15 PDB entries) Uniprot P09883 456-581 |
![]() | Domain d1v15c_: 1v15 C: [108238] complexed with zn; mutant |
PDB Entry: 1v15 (more details), 2.4 Å
SCOPe Domain Sequences for d1v15c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v15c_ d.4.1.1 (C:) DNase domain of colicin E9 {Escherichia coli [TaxId: 562]} skrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweevs kdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnirvt tpkrhidih
Timeline for d1v15c_: