SCOPe 2.04: Domain d1v15b_: 1v15 B:

Lineage for d1v15b_ (1v15 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein DNase domain of colicin E9 [54064] (1 species)

7. Species Escherichia coli [TaxId:562] [54065] (15 PDB entries)
   Uniprot P09883 456-581

8. Domain d1v15b_: 1v15 B: [108237]
   complexed with zn; mutant

Details for d1v15b_

PDB Entry: 1v15, 2.4 Å

PDB Description: crystal structure of the colicin e9, mutant his103ala, in complex with zn+2 and dsdna (resolution 2.4a)

PDB Compounds: (B:) colicin e9

SCOPe Domain Sequences for d1v15b_:

Sequence; same for both SEQRES and ATOM records:

>d1v15b_ d.4.1.1 (B:) DNase domain of colicin E9 {Escherichia coli [TaxId: 562]}
meskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavwee
vskdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnir
vttpkrhidihrgk

Timeline for d1v15b_:

• d1v15b_ first appeared in SCOP 1.69
  
• d1v15b_ appears in SCOPe 2.03
  
• d1v15b_ appears in SCOPe 2.05
  
• d1v15b_ appears in the current release, SCOPe 2.08