Lineage for d1v14c_ (1v14 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597354Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 597355Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 597356Family d.4.1.1: HNH-motif [54061] (2 proteins)
  6. 597367Protein DNase domain of colicin E9 [54064] (1 species)
  7. 597368Species Escherichia coli [TaxId:562] [54065] (7 PDB entries)
  8. 597384Domain d1v14c_: 1v14 C: [108234]

Details for d1v14c_

PDB Entry: 1v14 (more details), 2.9 Å

PDB Description: crystal structure of the colicin e9, mutant his103ala, in complex with mg+2 and dsdna (resolution 2.9a)

SCOP Domain Sequences for d1v14c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v14c_ d.4.1.1 (C:) DNase domain of colicin E9 {Escherichia coli}
eskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweev
skdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnirv
ttpkrhidihrg

SCOP Domain Coordinates for d1v14c_:

Click to download the PDB-style file with coordinates for d1v14c_.
(The format of our PDB-style files is described here.)

Timeline for d1v14c_: