SCOP 1.71: Domain d1v14b_: 1v14 B:

Lineage for d1v14b_ (1v14 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (2 proteins)

6. Protein DNase domain of colicin E9 [54064] (1 species)

7. Species Escherichia coli [TaxId:562] [54065] (7 PDB entries)

8. Domain d1v14b_: 1v14 B: [108233]

Details for d1v14b_

PDB Entry: 1v14, 2.9 Å

PDB Description: crystal structure of the colicin e9, mutant his103ala, in complex with mg+2 and dsdna (resolution 2.9a)

SCOP Domain Sequences for d1v14b_:

Sequence; same for both SEQRES and ATOM records:

>d1v14b_ d.4.1.1 (B:) DNase domain of colicin E9 {Escherichia coli}
meskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavwee
vskdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnir
vttpkrhidihr

Timeline for d1v14b_:

• d1v14b_ first appeared in SCOP 1.69
  
• d1v14b_ appears in SCOP 1.73
  
• d1v14b_ appears in the current release, SCOPe 2.08