Lineage for d1v10a3 (1v10 A:305-494)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457650Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 457651Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 457981Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 458022Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 458037Species Rigidoporus lignosus [TaxId:219653] [110102] (1 PDB entry)
  8. 458040Domain d1v10a3: 1v10 A:305-494 [108226]

Details for d1v10a3

PDB Entry: 1v10 (more details), 1.7 Å

PDB Description: structure of rigidoporus lignosus laccase from hemihedrally twinned crystals

SCOP Domain Sequences for d1v10a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus}
neanliplinpgapgnpvpggadinlnlrigrnattadftingapfipptvpvllqilsg
vtnpndllpggavislpanqvieisipgggnhpfhlhghnfdvvrtpgssvynyvnpvrr
dvvsiggggdnvtfrfvtdnpgpwflhchidwhleaglavvfaedipnipianaispawd
dlcpkynann

SCOP Domain Coordinates for d1v10a3:

Click to download the PDB-style file with coordinates for d1v10a3.
(The format of our PDB-style files is described here.)

Timeline for d1v10a3: