Lineage for d1v10a1 (1v10 A:1-136)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381069Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 2381132Species Rigidoporus lignosus [TaxId:219653] [110102] (1 PDB entry)
    Uniprot Q6H9H7 22-515
  8. 2381133Domain d1v10a1: 1v10 A:1-136 [108224]
    complexed with cu

Details for d1v10a1

PDB Entry: 1v10 (more details), 1.7 Å

PDB Description: structure of rigidoporus lignosus laccase from hemihedrally twinned crystals
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d1v10a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]}
atvaldlhilnanldpdgtgarsavtaegttiaplitgniddrfqinvidqltdanmrra
tsihwhgffqagttemdgpafvnqcpiipnesfvydfvvpgqagtywyhshlstqycdgl
rgafvvydpndphlsl

SCOPe Domain Coordinates for d1v10a1:

Click to download the PDB-style file with coordinates for d1v10a1.
(The format of our PDB-style files is described here.)

Timeline for d1v10a1: