SCOP 1.73: Domain d1v10a1: 1v10 A:1-136

Lineage for d1v10a1 (1v10 A:1-136)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Laccase [49557] (5 species)
   consists of three domains of this fold

7. Species Rigidoporus lignosus [TaxId:219653] [110102] (1 PDB entry)

8. Domain d1v10a1: 1v10 A:1-136 [108224]

Details for d1v10a1

PDB Entry: 1v10, 1.7 Å

PDB Description: structure of rigidoporus lignosus laccase from hemihedrally twinned crystals

PDB Compounds: (A:) laccase

SCOP Domain Sequences for d1v10a1:

Sequence; same for both SEQRES and ATOM records:

>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]}
atvaldlhilnanldpdgtgarsavtaegttiaplitgniddrfqinvidqltdanmrra
tsihwhgffqagttemdgpafvnqcpiipnesfvydfvvpgqagtywyhshlstqycdgl
rgafvvydpndphlsl

Timeline for d1v10a1:

• d1v10a1 first appeared in SCOP 1.69
  
• d1v10a1 appears in SCOP 1.71
  
• d1v10a1 appears in SCOP 1.75
  
• d1v10a1 appears in the current release, SCOPe 2.08