Class b: All beta proteins [48724] (165 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Laccase [49557] (5 species) consists of three domains of this fold |
Species Rigidoporus lignosus [TaxId:219653] [110102] (1 PDB entry) |
Domain d1v10a1: 1v10 A:1-136 [108224] |
PDB Entry: 1v10 (more details), 1.7 Å
SCOP Domain Sequences for d1v10a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} atvaldlhilnanldpdgtgarsavtaegttiaplitgniddrfqinvidqltdanmrra tsihwhgffqagttemdgpafvnqcpiipnesfvydfvvpgqagtywyhshlstqycdgl rgafvvydpndphlsl
Timeline for d1v10a1: