Lineage for d1v0ya2 (1v0y A:264-514)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1670568Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 1670569Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 1670575Family d.136.1.2: Phospholipase D [64391] (1 protein)
    duplication: contains two domains of this fold arranged as in the Nuc dimer
  6. 1670576Protein Phospholipase D [64392] (1 species)
  7. 1670577Species Streptomyces sp. [TaxId:1931] [64393] (8 PDB entries)
    Uniprot P84147
  8. 1670589Domain d1v0ya2: 1v0y A:264-514 [108223]
    complexed with hi5

Details for d1v0ya2

PDB Entry: 1v0y (more details), 1.71 Å

PDB Description: phospholipase d from streptomyces sp. strain pmf soaked with the substrate dibutyrylphosphatidylcholine.
PDB Compounds: (A:) phospholipase d

SCOPe Domain Sequences for d1v0ya2:

Sequence, based on SEQRES records: (download)

>d1v0ya2 d.136.1.2 (A:264-514) Phospholipase D {Streptomyces sp. [TaxId: 1931]}
nvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdntnadrdydtvnpeesalr
alvasakghieisqqdlnatcpplprydirlydalaakmaagvkvrivvsdpanrgavgs
ggysqikslseisdtlrnrlanitggqqaaktamcsnlqlatfrsspngkwadghpyaqh
hklvsvdsstfyigsknlypswlqdfgyivespeaakqldaklldpqwkysqetatvdya
rgicna

Sequence, based on observed residues (ATOM records): (download)

>d1v0ya2 d.136.1.2 (A:264-514) Phospholipase D {Streptomyces sp. [TaxId: 1931]}
nvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdntnadrdydtvnpeesalr
alvasakghieisqqdlnatcpplprydirlydalaakmaagvkvrivvsdpanrgysqi
kslseisdtlrnrlanitggqqaaktamcsnlqlatfrsspngkwadghpyaqhhklvsv
dsstfyigsknlypswlqdfgyivespeaakqldaklldpqwkysqetatvdyargicna

SCOPe Domain Coordinates for d1v0ya2:

Click to download the PDB-style file with coordinates for d1v0ya2.
(The format of our PDB-style files is described here.)

Timeline for d1v0ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v0ya1