Lineage for d1v0va2 (1v0v A:264-513)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. Family d.136.1.2: Phospholipase D [64391] (1 protein)
    duplication: contains two domains of this fold arranged as in the Nuc dimer
  6. Protein Phospholipase D [64392] (1 species)
  7. Species Streptomyces sp. [TaxId:1931] [64393] (8 PDB entries)
    Uniprot P84147
  8. Domain d1v0va2: 1v0v A:264-513 [108219]
    complexed with po3

Details for d1v0va2

PDB Entry: 1v0v (more details), 1.7 Å

PDB Description: phospholipase d from streptomyces sp. strain pmf soaked with the substrate dibutyrylphosphatidylcholine.
PDB Compounds: (A:) phospholipase d

SCOPe Domain Sequences for d1v0va2:

Sequence, based on SEQRES records: (download)

>d1v0va2 d.136.1.2 (A:264-513) Phospholipase D {Streptomyces sp. [TaxId: 1931]}
nvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdntnadrdydtvnpeesalr
alvasakghieisqqdlnatcpplprydirlydalaakmaagvkvrivvsdpanrgavgs
ggysqikslseisdtlrnrlanitggqqaaktamcsnlqlatfrsspngkwadghpyaqh
hklvsvdsstfyigsknlypswlqdfgyivespeaakqldaklldpqwkysqetatvdya
rgicn

Sequence, based on observed residues (ATOM records): (download)

>d1v0va2 d.136.1.2 (A:264-513) Phospholipase D {Streptomyces sp. [TaxId: 1931]}
nvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdntnadrdydtvnpeesalr
alvasakghieisqqdlnatcpplprydirlydalaakmaagvkvrivvsdpanrgysqi
kslseisdtlrnrlanitggqqaaktamcsnlqlatfrsspngkwadghpyaqhhklvsv
dsstfyigsknlypswlqdfgyivespeaakqldaklldpqwkysqetatvdyargicn

SCOPe Domain Coordinates for d1v0va2 are not available.

Timeline for d1v0va2:

Domains from same chain:
(mouse over for more information)
d1v0va1