Lineage for d1v0ua1 (1v0u A:6-263)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216700Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2216701Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2216707Family d.136.1.2: Phospholipase D [64391] (1 protein)
    duplication: contains two domains of this fold arranged as in the Nuc dimer
  6. 2216708Protein Phospholipase D [64392] (1 species)
  7. 2216709Species Streptomyces sp. [TaxId:1931] [64393] (8 PDB entries)
    Uniprot P84147
  8. 2216714Domain d1v0ua1: 1v0u A:6-263 [108216]
    complexed with po3

Details for d1v0ua1

PDB Entry: 1v0u (more details), 1.42 Å

PDB Description: phospholipase d from streptomyces sp. strain pmf soaked with the product glycerophosphate.
PDB Compounds: (A:) phospholipase d

SCOPe Domain Sequences for d1v0ua1:

Sequence, based on SEQRES records: (download)

>d1v0ua1 d.136.1.2 (A:6-263) Phospholipase D {Streptomyces sp. [TaxId: 1931]}
satphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvgaa
pvyhmnvipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltgg
inswkddyldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgnag
cmptmhkdtnpkaspatg

Sequence, based on observed residues (ATOM records): (download)

>d1v0ua1 d.136.1.2 (A:6-263) Phospholipase D {Streptomyces sp. [TaxId: 1931]}
satphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvgav
ipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltgginswkdd
yldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgnagcmptmhk
dtnpkaspatg

SCOPe Domain Coordinates for d1v0ua1:

Click to download the PDB-style file with coordinates for d1v0ua1.
(The format of our PDB-style files is described here.)

Timeline for d1v0ua1:

Domains from same chain:
(mouse over for more information)
d1v0ua2