Lineage for d1v0ua1 (1v0u A:6-263)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611345Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 611346Superfamily d.136.1: Phospholipase D/nuclease [56024] (3 families) (S)
  5. 611352Family d.136.1.2: Phospholipase D [64391] (1 protein)
    duplication: contains two domains of this fold arranged as in the Nuc dimer
  6. 611353Protein Phospholipase D [64392] (1 species)
  7. 611354Species Streptomyces sp. [TaxId:1931] [64393] (8 PDB entries)
  8. 611359Domain d1v0ua1: 1v0u A:6-263 [108216]

Details for d1v0ua1

PDB Entry: 1v0u (more details), 1.42 Å

PDB Description: phospholipase d from streptomyces sp. strain pmf soaked with the product glycerophosphate.

SCOP Domain Sequences for d1v0ua1:

Sequence, based on SEQRES records: (download)

>d1v0ua1 d.136.1.2 (A:6-263) Phospholipase D {Streptomyces sp.}
satphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvgaa
pvyhmnvipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltgg
inswkddyldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgnag
cmptmhkdtnpkaspatg

Sequence, based on observed residues (ATOM records): (download)

>d1v0ua1 d.136.1.2 (A:6-263) Phospholipase D {Streptomyces sp.}
satphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvgav
ipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltgginswkdd
yldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgnagcmptmhk
dtnpkaspatg

SCOP Domain Coordinates for d1v0ua1:

Click to download the PDB-style file with coordinates for d1v0ua1.
(The format of our PDB-style files is described here.)

Timeline for d1v0ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v0ua2