Lineage for d1v0ta2 (1v0t A:264-513)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1927884Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 1927885Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 1927891Family d.136.1.2: Phospholipase D [64391] (1 protein)
    duplication: contains two domains of this fold arranged as in the Nuc dimer
  6. 1927892Protein Phospholipase D [64392] (1 species)
  7. 1927893Species Streptomyces sp. [TaxId:1931] [64393] (8 PDB entries)
    Uniprot P84147
  8. 1927901Domain d1v0ta2: 1v0t A:264-513 [108215]
    complexed with po3

Details for d1v0ta2

PDB Entry: 1v0t (more details), 1.53 Å

PDB Description: phospholipase d from streptomyces sp. strain pmf soaked with the product glycerophosphate
PDB Compounds: (A:) phospholipase d

SCOPe Domain Sequences for d1v0ta2:

Sequence, based on SEQRES records: (download)

>d1v0ta2 d.136.1.2 (A:264-513) Phospholipase D {Streptomyces sp. [TaxId: 1931]}
nvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdntnadrdydtvnpeesalr
alvasakghieisqqdlnatcpplprydirlydalaakmaagvkvrivvsdpanrgavgs
ggysqikslseisdtlrnrlanitggqqaaktamcsnlqlatfrsspngkwadghpyaqh
hklvsvdsstfyigsknlypswlqdfgyivespeaakqldaklldpqwkysqetatvdya
rgicn

Sequence, based on observed residues (ATOM records): (download)

>d1v0ta2 d.136.1.2 (A:264-513) Phospholipase D {Streptomyces sp. [TaxId: 1931]}
nvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdntnadrdydtvnpeesalr
alvasakghieisqqdlnatcpplprydirlydalaakmaagvkvrivvsdpanrgysqi
kslseisdtlrnrlanitggqqaaktamcsnlqlatfrsspngkwadghpyaqhhklvsv
dsstfyigsknlypswlqdfgyivespeaakqldaklldpqwkysqetatvdyargicn

SCOPe Domain Coordinates for d1v0ta2:

Click to download the PDB-style file with coordinates for d1v0ta2.
(The format of our PDB-style files is described here.)

Timeline for d1v0ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v0ta1