Lineage for d1v0ka_ (1v0k A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571449Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 571750Protein Xylanase A, catalytic core [51514] (8 species)
  7. 571789Species Streptomyces lividans [TaxId:1916] [51515] (9 PDB entries)
  8. 571791Domain d1v0ka_: 1v0k A: [108206]
    complexed with xdn, xyp

Details for d1v0ka_

PDB Entry: 1v0k (more details), 1.03 Å

PDB Description: xylanase xyn10a from streptomyces lividans in complex with xylobio- deoxynojirimycin at ph 5.8

SCOP Domain Sequences for d1v0ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0ka_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans}
estlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfnf
ssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgkiv
qwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwak
tqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiqg
apastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldaln
gg

SCOP Domain Coordinates for d1v0ka_:

Click to download the PDB-style file with coordinates for d1v0ka_.
(The format of our PDB-style files is described here.)

Timeline for d1v0ka_: