Lineage for d1v0ka_ (1v0k A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. Protein Xylanase A, catalytic core [51514] (8 species)
  7. Species Streptomyces lividans [TaxId:1916] [51515] (9 PDB entries)
    Uniprot P26514 43-344
  8. Domain d1v0ka_: 1v0k A: [108206]
    complexed with xdn, xyp

Details for d1v0ka_

PDB Entry: 1v0k (more details), 1.03 Å

PDB Description: xylanase xyn10a from streptomyces lividans in complex with xylobio- deoxynojirimycin at ph 5.8
PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d1v0ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0ka_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]}
estlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfnf
ssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgkiv
qwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwak
tqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiqg
apastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldaln
gg

SCOPe Domain Coordinates for d1v0ka_ are not available.

Timeline for d1v0ka_: