SCOP 1.71: Domain d1v0hx_: 1v0h X:

Lineage for d1v0hx_ (1v0h X:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Ascorbate peroxidase [48123] (3 species)

7. Species Soybean (Glycine max) [TaxId:3847] [89092] (3 PDB entries)

8. Domain d1v0hx_: 1v0h X: [108205]
   complexed with hem, na, sha

Details for d1v0hx_

PDB Entry: 1v0h, 1.46 Å

PDB Description: ascobate peroxidase from soybean cytosol in complex with salicylhydroxamic acid

SCOP Domain Sequences for d1v0hx_:

Sequence; same for both SEQRES and ATOM records:

>d1v0hx_ a.93.1.1 (X:) Ascorbate peroxidase {Soybean (Glycine max)}
sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgti
khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
klselgfad

Timeline for d1v0hx_:

• d1v0hx_ first appeared in SCOP 1.69
  
• d1v0hx_ appears in SCOP 1.73
  
• d1v0hx_ appears in the current release, SCOPe 2.08, called d1v0hx1