Lineage for d1v0da_ (1v0d A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2927847Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2927848Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2927986Family d.4.1.7: Caspase-activated DNase, CAD (DffB, DFF40) [110778] (1 protein)
  6. 2927987Protein Caspase-activated DNase, CAD (DffB, DFF40) [110779] (1 species)
  7. 2927988Species Mouse (Mus musculus) [TaxId:10090] [110780] (1 PDB entry)
    Uniprot O54788 85-329 # structure of the N-terminal, CAD domain (1-87) is solved separately; (54282)
  8. 2927989Domain d1v0da_: 1v0d A: [108204]
    complexed with mg, pb, zn

Details for d1v0da_

PDB Entry: 1v0d (more details), 2.6 Å

PDB Description: crystal structure of caspase-activated dnase (cad)
PDB Compounds: (A:) DNA fragmentation factor 40 kda subunit

SCOPe Domain Sequences for d1v0da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0da_ d.4.1.7 (A:) Caspase-activated DNase, CAD (DffB, DFF40) {Mouse (Mus musculus) [TaxId: 10090]}
vsditrflsvfnephagviqaarqqlsdeqaplrqklladllhhvsqnitaetreqdpsw
feglesrfrnksgylryscesrirgylrevsaytsmvdeaaqeeylrvlgsmcqklksvq
yngsyfdrgaeassrlctpegwfscqgpfdlesclskhsinpygnresrilfstwnldhi
iekkrtvvptlaeaiqdgrevnweyfysllftaenlklvhiachkktthklecdrsriyr
pqtgs

SCOPe Domain Coordinates for d1v0da_:

Click to download the PDB-style file with coordinates for d1v0da_.
(The format of our PDB-style files is described here.)

Timeline for d1v0da_: