Lineage for d1v07a_ (1v07 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302832Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins)
    lack the first helix but otherwise is more similar to conventional globins than the truncated ones
    automatically mapped to Pfam PF00042
  6. 2302833Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species)
  7. 2302834Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [74662] (13 PDB entries)
    Uniprot O76242
  8. 2302844Domain d1v07a_: 1v07 A: [108201]
    complexed with hem, oxy, so4; mutant

Details for d1v07a_

PDB Entry: 1v07 (more details), 1.7 Å

PDB Description: crystal structure of thre11val mutant of the nerve tissue mini-hemoglobin from the nemertean worm cerebratulus lacteus
PDB Compounds: (A:) neural hemoglobin

SCOPe Domain Sequences for d1v07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v07a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagkvvdyinaaiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl

SCOPe Domain Coordinates for d1v07a_:

Click to download the PDB-style file with coordinates for d1v07a_.
(The format of our PDB-style files is described here.)

Timeline for d1v07a_: