Lineage for d1v03a_ (1v03 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474776Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 474856Protein Plant beta-glucosidase (myrosinase) [51522] (4 species)
  7. 474878Species Sorghum bicolor [TaxId:4558] [110351] (2 PDB entries)
  8. 474885Domain d1v03a_: 1v03 A: [108200]

Details for d1v03a_

PDB Entry: 1v03 (more details), 2 Å

PDB Description: crystal structure of the sorghum bicolor dhurrinase 1

SCOP Domain Sequences for d1v03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v03a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor}
ihrlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrsn
gdvaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekgveyynklidll
lengiepyitifhwdtpqalveayggflderiikdytdfakvcfekfgktvknwltfndp
etfcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkga
dgriglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvpy
fkekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaigp
ptgnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldyi
qrhlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsarw
lqefnga

SCOP Domain Coordinates for d1v03a_:

Click to download the PDB-style file with coordinates for d1v03a_.
(The format of our PDB-style files is described here.)

Timeline for d1v03a_: