Lineage for d1v02a_ (1v02 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683071Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (5 proteins)
  6. 683196Protein Plant beta-glucosidase (myrosinase) [51522] (4 species)
  7. 683218Species Sorghum bicolor [TaxId:4558] [110351] (2 PDB entries)
  8. 683219Domain d1v02a_: 1v02 A: [108194]

Details for d1v02a_

PDB Entry: 1v02 (more details), 1.9 Å

PDB Description: crystal structure of the sorghum bicolor dhurrinase 1
PDB Compounds: (A:) dhurrinase

SCOP Domain Sequences for d1v02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]}
rlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrsngd
vaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidllle
ngiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgktvknwltfnepet
fcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkgadg
riglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvpyfk
ekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaigppt
gnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldyiqr
hlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsarwlq
efng

SCOP Domain Coordinates for d1v02a_:

Click to download the PDB-style file with coordinates for d1v02a_.
(The format of our PDB-style files is described here.)

Timeline for d1v02a_: