SCOPe 2.06: Domain d1v00d_: 1v00 D:

Lineage for d1v00d_ (1v00 D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (5 PDB entries)
   Uniprot Q6YD91

8. Domain d1v00d_: 1v00 D: [108193]
   complexed with ca, lat, mn

Details for d1v00d_

PDB Entry: 1v00, 1.7 Å

PDB Description: erythrina cristagalli lectin

PDB Compounds: (D:) lectin (ecl)

SCOPe Domain Sequences for d1v00d_:

Sequence; same for both SEQRES and ATOM records:

>d1v00d_ b.29.1.1 (D:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]}
vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet

Timeline for d1v00d_:

• d1v00d_ first appeared in SCOP 1.69
  
• d1v00d_ appears in SCOPe 2.05
  
• d1v00d_ appears in SCOPe 2.07
  
• d1v00d_ appears in the current release, SCOPe 2.08