Lineage for d1v00c_ (1v00 C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 459807Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 459934Protein Legume lectin [49904] (23 species)
  7. 459957Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (5 PDB entries)
  8. 459962Domain d1v00c_: 1v00 C: [108192]

Details for d1v00c_

PDB Entry: 1v00 (more details), 1.7 Å

PDB Description: erythrina cristagalli lectin

SCOP Domain Sequences for d1v00c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v00c_ b.29.1.1 (C:) Legume lectin {Cockspur coral tree (Erythrina crista-galli)}
vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
n

SCOP Domain Coordinates for d1v00c_:

Click to download the PDB-style file with coordinates for d1v00c_.
(The format of our PDB-style files is described here.)

Timeline for d1v00c_: