Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (5 PDB entries) Uniprot Q6YD91 |
Domain d1v00b_: 1v00 B: [108191] complexed with ca, lat, mn |
PDB Entry: 1v00 (more details), 1.7 Å
SCOPe Domain Sequences for d1v00b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v00b_ b.29.1.1 (B:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
Timeline for d1v00b_: