Lineage for d1v00b_ (1v00 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778506Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (7 PDB entries)
    Uniprot Q6YD91
  8. 2778510Domain d1v00b_: 1v00 B: [108191]
    complexed with ca, mn

Details for d1v00b_

PDB Entry: 1v00 (more details), 1.7 Å

PDB Description: erythrina cristagalli lectin
PDB Compounds: (B:) lectin (ecl)

SCOPe Domain Sequences for d1v00b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v00b_ b.29.1.1 (B:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]}
vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet

SCOPe Domain Coordinates for d1v00b_:

Click to download the PDB-style file with coordinates for d1v00b_.
(The format of our PDB-style files is described here.)

Timeline for d1v00b_: