Lineage for d1uzzd_ (1uzz D:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 459807Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 459934Protein Legume lectin [49904] (23 species)
  7. 459957Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (5 PDB entries)
  8. 459969Domain d1uzzd_: 1uzz D: [108189]

Details for d1uzzd_

PDB Entry: 1uzz (more details), 2.13 Å

PDB Description: erythrina cristagalli bound to n-linked oligosaccharide and lactose

SCOP Domain Sequences for d1uzzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzzd_ b.29.1.1 (D:) Legume lectin {Cockspur coral tree (Erythrina crista-galli)}
vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
n

SCOP Domain Coordinates for d1uzzd_:

Click to download the PDB-style file with coordinates for d1uzzd_.
(The format of our PDB-style files is described here.)

Timeline for d1uzzd_: