SCOPe 2.01: Domain d1uzzc_: 1uzz C:

Lineage for d1uzzc_ (1uzz C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (5 PDB entries)
   Uniprot Q6YD91

8. Domain d1uzzc_: 1uzz C: [108188]
   complexed with ca, gol, mn

Details for d1uzzc_

PDB Entry: 1uzz, 2.13 Å

PDB Description: erythrina cristagalli bound to n-linked oligosaccharide and lactose

PDB Compounds: (C:) lectin (ecl)

SCOPe Domain Sequences for d1uzzc_:

Sequence; same for both SEQRES and ATOM records:

>d1uzzc_ b.29.1.1 (C:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]}
vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
n

Timeline for d1uzzc_:

• d1uzzc_ first appeared in SCOP 1.69
  
• d1uzzc_ appears in SCOP 1.75
  
• d1uzzc_ appears in SCOPe 2.02
  
• d1uzzc_ appears in the current release, SCOPe 2.08