Lineage for d1uzza_ (1uzz A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388157Protein Legume lectin [49904] (23 species)
  7. 2388180Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (7 PDB entries)
    Uniprot Q6YD91
  8. 2388189Domain d1uzza_: 1uzz A: [108186]
    complexed with ca, gol, mn

Details for d1uzza_

PDB Entry: 1uzz (more details), 2.13 Å

PDB Description: erythrina cristagalli bound to n-linked oligosaccharide and lactose
PDB Compounds: (A:) lectin (ecl)

SCOPe Domain Sequences for d1uzza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzza_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]}
vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet

SCOPe Domain Coordinates for d1uzza_:

Click to download the PDB-style file with coordinates for d1uzza_.
(The format of our PDB-style files is described here.)

Timeline for d1uzza_: