![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein Legume lectin [49904] (23 species) |
![]() | Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (7 PDB entries) Uniprot Q6YD91 |
![]() | Domain d1uzza_: 1uzz A: [108186] complexed with ca, gol, mn |
PDB Entry: 1uzz (more details), 2.13 Å
SCOPe Domain Sequences for d1uzza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzza_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
Timeline for d1uzza_: