SCOP 1.71: Domain d1uzyb_: 1uzy B:

Lineage for d1uzyb_ (1uzy B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (5 PDB entries)

8. Domain d1uzyb_: 1uzy B: [108185]
   complexed with afl, bgc, bma, ca, epe, fuc, glb, man, mn, nag, xyp

Details for d1uzyb_

PDB Entry: 1uzy, 2 Å

PDB Description: erythrina crystagalli lectin

SCOP Domain Sequences for d1uzyb_:

Sequence; same for both SEQRES and ATOM records:

>d1uzyb_ b.29.1.1 (B:) Legume lectin {Cockspur coral tree (Erythrina crista-galli)}
vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpe

Timeline for d1uzyb_:

• d1uzyb_ first appeared in SCOP 1.69
  
• d1uzyb_ appears in SCOP 1.73
  
• d1uzyb_ appears in the current release, SCOPe 2.08