Lineage for d1uzya_ (1uzy A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663354Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (5 PDB entries)
  8. 663361Domain d1uzya_: 1uzy A: [108184]

Details for d1uzya_

PDB Entry: 1uzy (more details), 2 Å

PDB Description: erythrina crystagalli lectin
PDB Compounds: (A:) lectin (ecl)

SCOP Domain Sequences for d1uzya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzya_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]}
etisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiwd
mttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdnsy
qtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilla
vlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet

SCOP Domain Coordinates for d1uzya_:

Click to download the PDB-style file with coordinates for d1uzya_.
(The format of our PDB-style files is described here.)

Timeline for d1uzya_: