Lineage for d1uzya_ (1uzy A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042387Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (5 PDB entries)
    Uniprot Q6YD91
  8. 2042394Domain d1uzya_: 1uzy A: [108184]
    complexed with ca, epe, mn

Details for d1uzya_

PDB Entry: 1uzy (more details), 2 Å

PDB Description: erythrina crystagalli lectin
PDB Compounds: (A:) lectin (ecl)

SCOPe Domain Sequences for d1uzya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzya_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]}
etisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiwd
mttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdnsy
qtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilla
vlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet

SCOPe Domain Coordinates for d1uzya_:

Click to download the PDB-style file with coordinates for d1uzya_.
(The format of our PDB-style files is described here.)

Timeline for d1uzya_: